top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|154429047|154435505|+|ATP6AP1|ENST00000455205.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.965

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

3

Peptide

LDIADSPFLWLGGLPQMLLAAPPPPR

Amino Acids from 5' Exons

GLVGSCGRHSRPHHQRLAALYLLRSRPGAGSQECAAVPAGQGAPAPAHSPPVIGRQPGPLPPHRPFPKGSFSDLVPTVGRCGSSHGKACSKRFSGHGDSLGNGTNLIGGSDGPEARYLLSTKHFGYLTSNMVGGDYRPCLFIDEKTEAGGVTCPSSYSWVAELFLSLENAHLFSALALATLMSLSWFHCQGKGLSRYNVSLQLIDTTLVPAVCQSSLPIGAHNPHAVFLPIQDLCPKSRRGDHEMTLRQVSARPSLVGGLYGSLPLSPLVAVWADGGGLKSFQEVVNNIVKELSPSSTMPAIGGMKSLMTVSTSVKRHHLYQRAVSGKSFFFFFLRRSLALLPRLECSGAMSAQLTAPSASRVQAVLCLSLPSSDYRAPATTPSFLYFFVFLVEMGFHHVGQAGLELLTSSTHLSLPNCWDYRREPPRPACEGEFLSTNIPGSPSLRAFTHSFICPIWKAYYVPGIVKCWGYGSEQKNPSPHPQEADILVRVASKYVGIGYDVSVTAFREGSRLRGQSDWDAILDKGGQARPHGGDIAAILMEGGSRLGKDIPGTANARVLGEVCSWPAQGRAGVAGAQVRERGRRCRRWFAGGAMKDLVGHEGEGQLQFEMCEKALGNVEQGVVFLNRKPTGPTSSSWAFRLRTPVAKQQQGPAHKGGEAGRVCIPNRLGKLIKISSGPNWEGPEEAGDGSGGEQKDKGHLVVEKKGWGRGHCGPKSSKDFNARCFLQHVLRSSPLPFRQKQVGGGSRPDWTPTLLFSGWEACHKCSWLPHPLPAASLFPPQFLLSVGWARRLTPTPELPQVSCLQISPPHDCLPCLLTLPECWREE,DLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKVRPPQPTLPRSSGGSQAPSPHDTDAHSPREASVTLSQLGGVGRLMGRPVVNASVGMATASEMAPTLEEATDQRPGTYVPSTLDILSPIWWVGIIVPVCLMRRLRLEVKLVQAHTANGWQSCNSSCDDHNNDNWKMLTCLVLCRHLLHCHYLGFTAKESKVCRDTMFHYSIPLWFQPESANPPSQLELITRMLFSFPSRIFAPKAGVETMRLDSKSLLGPPLLVACMAHCPCSLPWLLCGQMVVASLFRRWIISNRNVLVLPCNQPLEANNLCEQFLHLNEDTTYIRGLVGNLFFFFFDGVSLCCPGWNAVVQCQLSSLHPPPPGFKQFSASASRVARITGRPPLHPANFCIFLYFRWGFTMLARLVLNSPRDPPTSASQTAGITGVSHRARPVRGNSYNPHKTSSQDPPVLGHSPIHSFAQYGKPTMCQVLSVGDMAVSRRTQAPTLRKLTFLGWPVNTKSVDMMSVLRPLGKEAGGDRVTGMLFIRVVRPGLIEEVIYEQRSWREGAVWGRTFLEQQMRGSWARCALGQLKEELVWLEHSEEKGVGDVGDGLQVARRSRTLAMRGKVSCSSKCVRKPWVTWSREWCDFSIKESPQDPPAVPGLSDEPRWPNSSKVLPTREGRLGECVYQTGGSLKSPQGLTGKGQRKLGMGVEGRSKRTKDICRLWRKRDGVGATVVLRAQKTSMLDASSSMFDPHLSPSAKSRWGEGPVQTGHSRLSFSLAGRPATNALGCPTPSPQLPCSLPSSSCLGGQGGLLLLSYHKSAACRSPHPMTAFHVFSPCPESAGGK,TCGLLRPTLMKATSPATCSSLPTIPPWSWVPGMCCCSCRTRCARPSPLSPGHREAARPPPPMTLTPIPQGKLQPCPNCREVWVVSWEGLTLQWAWRQPRKWHQLDWRKRRTRGQVPTEYQALWISDLVQYGGWGLSSLFVYREDGWRLSDLSKLIQLMGGRVVILAVMIIIMIIGKCSPVCFVGTCYTDVIILVSLPRKVRFVEIQCFTTVDRYHFGSSLSLPILPPNWSSPACCFPSHPGSLPQKQAWRPDDSKIASLCALPCWWPVWLIALVVSLGCCVGRWWWPEVFSGGGKYSQIGTESFYHVTSHWRHEIIFVNDSFYICKMKTPPISEGCEWEIFFFFFFETESRSVAQAGMQWCNVSSAHCTLRLPGSSSSLPQPPELGLQGARHYTQLIFVFFCIFSRDGVSPCWPGWSTPDLVIHPPQPPKLLGLQAATAPGLGGILIIHIKHLARIPQSGIHPFIHLPNMESLLCARYCEVLGIWQAEEPKPPPSGSHSCEGGQILSRYRICQCYGLGRKQAKGTELGCYFRGWSGQASLRRYMSSDLNGGREPFGEGHSWNSKCEGPGRGVLLASSRKSWCGWSTVSERKGEMEMVCRWLGDEVGPCRPGGRSVAVRNVESLGRGAGSGVISQLKKAHRTHQQFLGFPTENPGGQTAARSCPQGRGGWASVYTKQVREADNLLRALGRARGSWGWEWRVGAKGQRTSVGCGEKGMGSGPLWSELKRLQCSMLPPACSEILTSPLPPKAGGGRVPSRLDIADSPFLWLGGLPQMLLAAPPPPRSFPVPSPVPLVCRVGKAADSYSVTTSQLPADLPTPLPSMSSHPALRVLEGR

Amino Acids from 3' Exons

VHSGQPPLPSVCPALVYHGAPRSPQQWLRRLLQCFPGHRAQHLLLPLRVCQQPEQEGSPRGPHAALSLADDASGLP,FILANRLYPVSARHWFTMERLEVHSNGSVAYFNASQVTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQ,SFWPTASTQCLPGTGLPWSASKSTAMAPSPTSMLPRSQGPASTPSTASMSAAARRVVSSWPARSPLPGRCFRTS

bottom of page