top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|130230509|130236639|-|ZNF280C|ENST00000370978.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9744

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

SFIMEGMK

Amino Acids from 5' Exons

HCCPDMITKFLGVIVKSERPCDEDKTDSETGKLIMLVNEFYYGRHEGVTEKEPKTYTTFKCFSCSKVLKNNI,IVVQTLNFWELLNQNVHVMKTRLIQRQESSCSMSFIMEGMKESLRKSQRLTQPLNASVARKFLKIIL,LLSRHDNIFGSNCIRTSMRQDFRDRKVDHVSQVLLWKARSHERAKDLHNLMLQLLESSKY

Amino Acids from 3' Exons

VKILHMCNILLLLKTVLLQKNQRPVKMFLRIPPLHCLLALLQHPPKLCCQK,YEKYFICVETSFYFSKQCYSKKTKDQRCSSDKSLHFIAFNWLSSSDILPSYAVK,MKNTSYVLKHPSTSKVNSVTPKKPKTSEDVPQINPSTSLPLIGSPPVTSSQVMLSK

bottom of page