top of page

McDonnell Genome Institute

Washington University

CircRNA

chrX|129465519|129499841|-|SMARCA1|ENST00000371121.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9554

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

TAMVLKPFLLR

Amino Acids from 5' Exons

IARYKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAM,LQDTRLHFISCAFSMEPAKERTILRKKIDSFVCYTKWALIEKMYMKNDSVYEMLPSLDLTGLSSLGLP,CKIQGSISSVAHSVWNQQRKELYGRRILDLYVTQNGLRKCIRIKTVCTKCSPVILVYQVDCH

Amino Acids from 3' Exons

VLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQRE,FNHFCYAVKLMRRVCHLKRKRFTWGVRCNEN,FKTIFVTPYKNCREESATKGNKDLLGAEDATRM

bottom of page