McDonnell Genome Institute

Washington University

CircRNA

chrX|72593103|72602273|-|PHKA1|ENST00000339490.7

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9039

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LVLLEQPK

Amino Acids from 5' Exons

SPGTSMTPSSGSFPSAYDQQSSKDSRQGQWQRRRRLDGALNRVPVGFYQKVWKVLQK,HLEPLLQVVGPFLVHMISSHLKIVVKVNGNAEEGWMGHIEFQLDFIRKYGKFCR,TWNLYDSKWVLSCISAVIRSSRSMATPKKAGWGTESSSWILSESMESFAE

Amino Acids from 3' Exons

FVPLIQMSVLLFLSTRLVLLEQPKQNELGSCSKVRS,SSHFKCQSCYFYPRDWCCWSNQNRTNWDHAVKKDKA,RPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQ