McDonnell Genome Institute

Washington University

CircRNA

chrX|71247344|71247906|-|ZMYM3|ENST00000489332.1

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9943

64

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

GGAWLIPGERK

Amino Acids from 5' Exons

AVCCCTNRTSLRSWACAVSLVLTAPRPASAESPSNWMAAPGTSAVRTVRASTCCGTARGGSACERGGKEGSGEHGLWYARGVDRSPGRAASLPSLSWPDLQGEEHGLSRGKERAQRILGRQVPSFHPQAARCHACKRQGKLLETIHWRGQIRHFCNQQCLLRFYSQQNQPNLDTQSGPESLLN,LCAAVQTGLHEAGLVLYHLYLLLPDLPARSHRATGWQHLGLLQGLEQVPAVVLQGKEGQHASEAGKRAVGSTGCGTELGVWTDLQGGQPAFHLAGPISKGRSMAYPGGKKGPNAFGGRSDHPFDILRLPGAMRVSARGSCWRPSTGVGRSVISATSSVFCVSIASRTNPTWIPRVGPRAST,CVLLYKQDFTKKLGLCCITCTYCSQTCQRGVTEQLDGSTWDFCSEDCKSKYLLWYCKVRRVSMRARRERGQWGARAVVLSSGCGQISREGSQPSISKLARSPRGGAWLIPGERKGPTHFREAGLTILLTSSGCPVPCVAPGEAAGDHPLAWADPSFLQPAVSSAFLPAEPTQPGYPEWAREPPE

Amino Acids from 3' Exons

AVCCCTNRTSLRSWACAVSLVLTAPRPASAESPSNWMAAPGTSAVRTVRASTCCGTARGGSACERGGKEGSGEHGLWYARGVDRSPGRAASLPSLSWPDLQGEEHGLSRGKERAQRILGRQVPSFHPQAARCHACKRQGKLLETIHWRGQIRHFCNQQCLLRFYSQQNQPNLDTQSGPESLLN,LCAAVQTGLHEAGLVLYHLYLLLPDLPARSHRATGWQHLGLLQGLEQVPAVVLQGKEGQHASEAGKRAVGSTGCGTELGVWTDLQGGQPAFHLAGPISKGRSMAYPGGKKGPNAFGGRSDHPFDILRLPGAMRVSARGSCWRPSTGVGRSVISATSSVFCVSIASRTNPTWIPRVGPRAST,CVLLYKQDFTKKLGLCCITCTYCSQTCQRGVTEQLDGSTWDFCSEDCKSKYLLWYCKVRRVSMRARRERGQWGARAVVLSSGCGQISREGSQPSISKLARSPRGGAWLIPGERKGPTHFREAGLTILLTSSGCPVPCVAPGEAAGDHPLAWADPSFLQPAVSSAFLPAEPTQPGYPEWAREPPE