McDonnell Genome Institute

Washington University

CircRNA

chrX|54236937|54259338|-|WNK3|ENST00000354646.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9124

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

11

Peptide

ENLYPNQLELNNK

Amino Acids from 5' Exons

VITIPQQQSAKMTSFGIEHISVFSETNHSSEEAFIKTAKSQLVEIEPATQNPKTSFSYEKLQALQETCKENKGVPKQGDNFLSFSAACETDVSSVTPEKEFEETSATGSSMQSGSELLLKEREILTAGKQPSSDSEFSASLAGSGKSVAKTGPESNQCLPHHEEQAYAQTQSSLFYSPSSPMSSDDESEIEDEDLKVELQRLRE,LQFLSSSQQKHLLENTYQCSVRQTILVKKPLLKQQSLSWKNLPHKIQKLRFLMRSYKLFRKPVKKIKEFPNKVTTSYLSAQLVRLMYLQPQKRNLKKLQPQEVACSLDLNCCLKRERYLLGNSLALIVNFQPVLLAVESQWQRLVQRVISAYHTTKNKLMLKHRVHSSIRHLPQAVMMNQKRMRTRWSFKDYEK,DYNSSAAVSKNDIFWNRTHISVQDKPFRSLYNSKVSVGRNRTCHTKSKNFVFLEVTSSSGNLRKRSSQTRQLLIFQRSLDCIFSDPRKGIRNFSHRKHAVWITVARERDIDCWETALIFSQSCWQWKVSGKDWSRESVLTTPRRTSLCSNTEFTLLFAIFPNEQIRNRGGLEGGASKITRK

Amino Acids from 3' Exons

PVSQPVGAEQQAALLKPDLVR,LYPNQLELNNKQLFNQIFE,CIPTSWSTTSSSSKTRFSSK