McDonnell Genome Institute

Washington University

CircRNA

chrX|54085714|54116794|-|FAM120C|ENST00000375180.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.918

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

GFAVPSVILK

Amino Acids from 5' Exons

ADLATKVEKMRQSILEGVNMNHPPPSALLPSPTFVPPMVPSLYPVSLYSRAMGSMPLPPQGRSRGFA,LTWQPKWKRDRASLKESTIIHRLLLYFRHLLLCLPWCPLSTLFHFIPELWAPCHFPLKGGAGDLQ,PGNQSGKDETEHPRSQHESSTAFCSTSVTYFCASHGALSLPCFTLFPSYGLHATSPSREEPGIC

Amino Acids from 3' Exons

FLQSLKSGLPIKGSHLKPLSWCLHHFGNGLAQTSRSSGAKQLKTRTEGCGPSWPVSRTRPVCSIQLMSPPICCSCVVYS,SFSDPRVVCLREVTSNPAGVCTDISGMDLPKPQEALARQSSRQEQKDAGLPGLYEVGHAQYAQSSCPHPSAAHVLCTP,PSVILKEWSAYKGKSPQTPELVSALTFREWTCPNLKKLWLGKAVEDKNRRMRAFLACMKSDTPSMLNPANVPTHLLLMCCVL