McDonnell Genome Institute

Washington University

CircRNA

chrX|53634235|53647574|-|HUWE1|ENST00000218328.12

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9355

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

12

Peptide

LHMMCELYHWVDLLDR

Amino Acids from 5' Exons

SWGGKENGFGLAECCRDLHMM,AGVERRMALDLQNVAETCI,LGWKGEWLWTCRMLQRLAYD

Amino Acids from 3' Exons

CELYHWVDLLDRFDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIE,ASYITGWTCWTASMEYWQMLDRQWRICHGCSYVIGQKESNKCFSWLCTSQPCSLSTAFPGICTVP,RVISLGGPVGPLRWNTGRCWTDSGEYVMDARMARKRATENASLGCVELHSLAHVQLFPASVQFHR