McDonnell Genome Institute

Washington University

CircRNA

chrX|53607522|53614745|-|HUWE1|ENST00000218328.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9655

65

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

SILLLEEICNLGR

Amino Acids from 5' Exons

MKFVESILSNNTTDDHCQEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSIL,NLWNLFATIQQMTTARNLIRKDCCLWLPFWVFPICPLTFPHLLPVRLLQVSANPY,EICGIYSEQQYNRPLPGICESERTVAFGYHFGSSQSAHLSHICCLSGCCRCLQIHI

Amino Acids from 3' Exons

LLEEICNLGRDPKYICQKPSIQKADGTATAPPPRSNHAAEEASSEDEEEEEVQAMQSFNSTQQNETEPNQ,YLKKSVILEGTPNTSVRSHQSRRQMALPLLLPQGLIMPQKKPLVRMRRKRKYRPCRALILPSKMKLSLIS,TRNLSWKGPQIHLSEAINPEGRWHCHCSSPKVSCRRRSLGGGRGSTGHAELFYPAKNASA