McDonnell Genome Institute

Washington University

CircRNA

chrX|53602563|53604834|-|HUWE1|ENST00000218328.12

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9185

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LGVNLAR

Amino Acids from 5' Exons

PTIWVIWPGRYAETGSKGEGRYDPGRKKI,LPSGCEFGQADMQKLVPKDEKAGTTQGGKRS,YHLGVNLARQICRNWFQRMRRQVRPRAEKDQ

Amino Acids from 3' Exons

TLSHEPKVLQEGLLQLDSILSSLEPLHRPIESPGGSVLLRELACAGNVADATLSAQATPLLHALTAAHAYIMMFVHTCRVGQ,HCHMNPKSFKRVSFSWTPSSPPWSPYTAPLNPLGAQCCCENWLAQAMLLMLPSQPRPHLCCMHSLLPMPTSCLFILAELD,TVTTQSPSRGSPSVGLHPLLPGALTPPHIPWGLSVVARTGLRRQCCCYPLSPGHTSAACTHCCPCLHHDVCSYLQSWT