McDonnell Genome Institute

Washington University

CircRNA

chrX|53551265|53552441|-|HUWE1|ENST00000262854.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

28

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

36

6

Peptide

TAPSTNSSAPAVVGNPGVTEVSPEFLAALPPAIQEELPTCIL

Amino Acids from 5' Exons

VSVSLKVWTPLFWLPCLMTSVGKFYRTSAFVHQPGLPPPQIAQRLQWWGILVLKALSFWLPCLQPFRR,YQSPRCGPLFSGCPAHPSGSSTEPARHSSTNPDCPLHKLSACSGGESWCDSEPVSGCPASSHSGG,ISLPEGVDPSFLAALPDDIRREVLQNQLGIRPPTRTAPSTNSSAPAVVGNPGVTEVSPEFLAALPPAIQEE

Amino Acids from 3' Exons

LPTCILELFHQRFCRGHFWSRFPRNPRRAVAFNKQRRRSPC,SPPASSESSSTRDSAVAISGADSRGILEEPLPSTSSEEEDPLA,PHLHPLRALPPEILPWPFLEQIPEESKSRCLQQAVKKKIPLR