McDonnell Genome Institute

Washington University

CircRNA

chrX|53411994|53412253|-|SMC1A|ENST00000322213.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.973

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

8

Peptide

DLTLEENQGEGLR

Amino Acids from 5' Exons

GEGLRIEPEAASVHQSQGEHLPQNQEAGSSQEVSAECSEALQEARHGAGEGDAVSGEGSAGVRTDGRRESESGQRFDVGGES,EKDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQ,RRTQNTRSGLSTSKPRRTPPTKSRSWKQPRSLCRMLRSTTRSVKVTWMSWRRRCCQWRRLGRSLKNGWKKRVRVRAEIRWRRI

Amino Acids from 3' Exons

GEGLRIEPEAASVHQSQGEHLPQNQEAGSSQEVSAECSEALQEARHGAGEGDAVSGEGSAGVRTDGRRESESGQRFDVGGES,EKDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQSQGRDLTLEENQ,RRTQNTRSGLSTSKPRRTPPTKSRSWKQPRSLCRMLRSTTRSVKVTWMSWRRRCCQWRRLGRSLKNGWKKRVRVRAEIRWRRI