McDonnell Genome Institute

Washington University

CircRNA

chrX|53409420|53415169|-|SMC1A|ENST00000322213.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9634

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

NTSPLASK

Amino Acids from 5' Exons

AKIKQKLREIEENQKRIEKLEEYITTS,PRSSKSCGKLKRIRSGLRNWRNTSPLA,QDQAKAAGNRESEADETGGIHHHQ

Amino Acids from 3' Exons

VSQISWMPSALCVKKPATCGRPCGTSMELLWASQLPTGPLSAWSTLRRVLRTVPLPVSL,VKSHGCHQLCARKNQQPAGKDPAGPDPWSSCGQASCQPGLCQHGLLGGCGPYLCPCHC,KSNLMDAISFVLGEKTSNLRVKTLRDLIHGAPVGKPAANRAFVSMVYSEEGAEDRTFARVIV