McDonnell Genome Institute

Washington University

CircRNA

chrX|3641851|3655412|-|PRKX|ENST00000262848.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9059

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

8

Peptide

LIFEMLSGFWTWHDER

Amino Acids from 5' Exons

DLDPLWNTRVPSPRSHSEQGPRKGRGLVGPRHPDIRDAFG,TWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLS,LGPSVEHPSTPPKSFRARATEGPWTGGPSASYSRCFR

Amino Acids from 3' Exons

VLDVARALPLHAHGVRAGRRALQLPAQPGALLQHHGALLLCRDHLCHRVPALQRDRLQGLEAREHPAGGWPHAHGLWVRQEAGRQ,FWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVD,SGRGMTSASSTCSWSTCRAASSSATCATGGASPAPRGSSTLQRSSVPSSTCTPKRSSTGTSQRTSCWIGMATLSSRTLGSPRSWT