McDonnell Genome Institute

Washington University

CircRNA

chrX|32468497|32472309|-|DMD|ENST00000357033.8

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9776

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

11

Peptide

IQFLTLCHQCAIR

Amino Acids from 5' Exons

ALQSSLQEQQSGLYYLSTTVKEMSKKAPSEISRKYQSEFEEIEGRWKKLSSQLVEHCQKLEEQMNKLRKIQ,LYKVLCKSNKVAYTISAPLKRCRRKRPLKLAGNINQNLKKLRDAGRSSPPSWLSIVKSRSKINSEKF,FTKFSARATKWPILSQHHCERDVEESALNPEISIRIRNGTLEEALLPAGALSKARGANETPKNS

Amino Acids from 3' Exons

FLTLCHQCAIRRPVPSGHGSSSQKPNSPYLNLVSPTMKSWSRDSGNC,FHFATNALSGDHECHQDMGPAVRNQTLHTSTCHRLNHGAETRGIA,FDTLPPMRYQETMSAIRTWVQQSETKLSIPQLSVTDYEIMEQRLGELQ