McDonnell Genome Institute

Washington University

CircRNA

chrX|32464585|32491518|-|DMD|ENST00000357033.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9565

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

AAETVQK

Amino Acids from 5' Exons

NHIQTLKKWMAEVDVFLKEEWPALGDSEILKKQLKQCR,ITYKPRNGWLKLMFFRRNGLPLGIQKFKSSNSA,SHTNPEEMDGSCFSEGGMACPWGFRNSKKAAETVQ

Amino Acids from 3' Exons

RVLMQIASNKPQNNTAGGSNSASCVRDLTGWSIRTTSSLSIISYNNWSRQLLLKTGKSNPPPHQSQQQLKVSKFV,GCCRHQTSLRTTEQPVDRILPVAKETLAGVSEQHHRFLSATTIGADDNYCKLVENPTHHPIRANSNKSVKNL,GVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIIAFYNQLQQLEQMTTTAENWLKIQPTTPSEPTAIKSQLKICK