McDonnell Genome Institute

Washington University

CircRNA

chrX|32342099|32491518|-|DMD|ENST00000357033.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.919

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

RLNFAQIR

Amino Acids from 5' Exons

EIDRELQKKKEELNAVRRQAEGLSEDGAAMAVEPTQIQLSKRWREIESKFAQFRRLNFAQI,KLIGNCRRRKRSMQCVGKLRACLRMGPQWQWSQLRSSSASAGGKLRANLLSFEDSTLHK,NSGIAEEERGAECSAASGLVGWGRNGSGANSDPAQQALAGNEQICSVSKTQLCTN

Amino Acids from 3' Exons

RVLMQIASNKPQNNTAGGSNSASCVRDLTGWSIRTTSSLSIISYNNWSRQLLLKTGKSNPPPHQSQQQLKVSKFV,GCCRHQTSLRTTEQPVDRILPVAKETLAGVSEQHHRFLSATTIGADDNYCKLVENPTHHPIRANSNKSVKNL,GVNADSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIIAFYNQLQQLEQMTTTAENWLKIQPTTPSEPTAIKSQLKICK