McDonnell Genome Institute

Washington University

CircRNA

chrX|23730815|23736016|-|ACOT9|ENST00000494361.5

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

QGIFHIHEGK

Amino Acids from 5' Exons

RPCEGNGRKEITSFLGITGWTASENEGQLYSSLAFGQAITREIFDCSKHRK,DHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTV,TMRQWKKGNYFIVSWLNHRMDCLLGERTVILKFSCLWAVSLNYERNILFKTP

Amino Acids from 3' Exons

ALCLGQRAAYSWKRTDSRTPEPQETGNLPHSRQAWCLCLMPM,LCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEGKHGVSVCLC,FVPWAKGSLLLEEDLKDPRTPRNRESSTFMKASMVSLFDAYV