McDonnell Genome Institute

Washington University

CircRNA

chrX|18918680|18926587|-|PHKA2|ENST00000379942.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9564

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

10

Peptide

GLEVPFTVLAENNHIK

Amino Acids from 5' Exons

KAKTNLTIISTTFCKAHRGPICLLFVRTQKTAMSSVLSTPRGTYFLWQKQRVWKFH,KPRRTPLYQPPSAKHIVEVLSASSLEHRRPPCLQCYPLHAGHTFCDGKSKGFGSS,SQDELDHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVP

Amino Acids from 3' Exons

LLFWQKTITLRTYGNTGTSRVSRTFIQFKSSRAGFLVTYMPSL,YCFGRKQSHGLIEETRGERPEYRGHSSNSSPAGPDSSHICQA,TVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKL