McDonnell Genome Institute

Washington University

CircRNA

chrX|154352771|154352924|-|FLNA|ENST00000344736.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9066

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

13

Peptide

FADQHVPGYGGLSLSIEGPSK

Amino Acids from 5' Exons

AMVGSACPLRAPARWTSTQRTWRTGRAGSPTAPQSQATTSSTSSLPTSTCL,LWWAQPVHGPQQGGHQHRGPGGRDVQGHLLPHRARQLHHQHQVCRPARA,YGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVP

Amino Acids from 3' Exons

AMVGSACPLRAPARWTSTQRTWRTGRAGSPTAPQSQATTSSTSSLPTSTCL,LWWAQPVHGPQQGGHQHRGPGGRDVQGHLLPHRARQLHHQHQVCRPARA,YGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVP