McDonnell Genome Institute

Washington University

CircRNA

chrX|154352180|154352675|-|FLNA|ENST00000344736.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9382

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

6

Peptide

AEAGVPGSPFSVK

Amino Acids from 5' Exons

KLASRIQPRPAHRARPMRPRSWKGRTTPTASALFPLRWAHTQSASTRASTCLGAPSSSPWGPGKGEPTRSELGALAWRELKLECQ,NHPGYDSPGDQPIGQDPGRDRGRGEPHLLHPLCSRDGHTHSQREVQGPARAWEPLPVHRGAPRGRGSPQGPSWGPWPGESSWSA,ISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVP

Amino Acids from 3' Exons

AAPSLRQARAGKRASPAGVGLLQWPTLVVIVTSAKSL,QPLLCEGDRRGPGEREHHPQASGSFSGQRWSLPQPENP,SPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIP