McDonnell Genome Institute

Washington University

CircRNA

chrX|154351883|154352924|-|FLNA|ENST00000344736.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9102

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

27

Peptide

DGSCGVAYVVQEPGYGGLSLSIEGPSKVDINTEDLEDGTCR

Amino Acids from 5' Exons

PNSVSGPGKLVLEAWPLLSRAPARLRSLLRTARTAPVVWLMWSRSQ,RIQYLDPGSWCWRPGHCCRGPQQGDLFGPQGRLLWCGLCGPGA,EFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEP

Amino Acids from 3' Exons

AMVGSACPLRAPARWTSTQRTWRTGRAGSPTAPQSQATTSSTSSLPTSTCL,LWWAQPVHGPQQGGHQHRGPGGRDVQGHLLPHRARQLHHQHQVCRPARA,YGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVP