McDonnell Genome Institute

Washington University

CircRNA

chrX|153952513|153953770|-|HCFC1|ENST00000369984.4

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

ALTTEVPIPAK

Amino Acids from 5' Exons

KISSMTETAPRALTTEVPIPAKITVTIANTETSDMPFSAVDILQPPEELQVSPGPRQQLPPRQLLQSASTALMGESAEVLSASQTPELPAAVDLSSTGEPSSGQESAGSAVVATVVVQPPPPTQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEAAAQAAATEEAQALAIQAVLQAAQQAVM,RSHQLRLPQGLLLKSPSRPKQPPTQKLLTCPSLLLTSCSPQRNSRCRQVLASSCRHGSFCSRLPQPWGSPPRSCQPPRPLSSRPPWIAAQGSHLRARSLPALRWWPLWWSSHPHPHSPKTSYHFPKSWPRPKLAPPPSWRGSPPRSWQRLLQKQLPRPQPRRKPRPWPSRRCSRPRSRPSW,DLINDDCPKGSDYSPHPGQNNSDHSQHRNFHALLCCHPAAPRGTPGVARSSPAAAATAASAVGFHSPDGGVRRGPVSLPDPAPGRRGSEQHRGAIFGPGVCRLCGGGHCGGPATPTHTVRSRPVITSPRANGRGPSWHHHPHGNGAHPRGAGSDGCCRSSCPGRSHGGSPGPGHPGGAPGRAAGRH

Amino Acids from 3' Exons

TPHLLPAIRERWRAPRATATSPAPVPSRQPCPPHRGLPPRSPHRSRAPLC,PPTCCQRSGRGGEHPGRQREHHQLQCHHDNRVLHTDAGCDHRDAVHTGPGPLCA,PPPAASDQGEVESTQGDSVNITSSSAITTTVSSTLTRAVTTVTQSTPVPGPSVP