McDonnell Genome Institute

Washington University

CircRNA

chrX|1417972|1425687|-|ASMTL|ENST00000381317.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9249

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

RQCRSTSQQGLLTACK

Amino Acids from 5' Exons

AARVHWPESWPVSTLVCRLCLTSQTLSSWPPTSNPPDRRQCRSTSQQ,LHGCTGPRAGPVPSYAGDCVPPRHYRAGRPLPTPRTAGSADPLRS,CTGALARELAREYPRMQVTVFDLPDIIELAAHFQPPGPQAVQIHFAA

Amino Acids from 3' Exons

GLLTACKLKVFDLLKDEAPQKAADIASKVDASACGMERLLDICAAMGLLEKTEQ,ACSPLANRCSICKMKHPRRLRILPAKWTPLRVEWRGFWTSVLPWGSWRRQSK,PAHRLQTEGVRFVKRSTPEGCGYCQQSGRLCVWNGEASGHLCCHGAPGEDRA