McDonnell Genome Institute

Washington University

CircRNA

chrX|136690609|136708770|-|ARHGEF6|ENST00000250617.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.902

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

GSMHISTDTLPSLGR

Amino Acids from 5' Exons

VGTIHGKSRCIEPRYPHFNNKPQQTIHATGEICYSLARVRTAYG,DELEQFMENQGASSPGILILTTNLSKPFMRLEKYVTLLQELERHME,MSWNNSWKIKVHRAQVSSFQQTSANHSCDWRNMLLSCKSNGIW

Amino Acids from 3' Exons

SEYCGGYIFTGKLRGSMHISTDTLPSLGRMFK,LSTVEVTSLLGNFEEVCTFQQTLCQALEECS,VLWRLHLYWETSRKYAHFNRHSAKPWKNVQ