McDonnell Genome Institute

Washington University

CircRNA

chrX|133753481|133953211|-|GPC3|ENST00000370818.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

AQHAAQER

Amino Acids from 5' Exons

RPLKLLFAMPRTTPMPCSRTTTQALHKLLSLWVNFSQMCLSTSWVLTSMMTWSMNCLTACFQSSIPSTQACLIQPWTSMSASEEQDVTKYLGISPSLLPRFPSHCKSLGSSFRLILELKSTQLITSSVRTVAECSPECGTALTARDWLNPVAVTAMWSCKAVWQVWWRLTSTGENTFCPLKNLMACTESMTWRTYCLVSFQQSMILSSMSRRMQESPP,GLNCCSPCQELHQCHVQEQLPKPDSTSFVCGIFHRCVSLHLGFHQCRHGQIVQPVSSHLYPANEPRPAFSLGHQVPPRSKTPESIWEFPQAYYDPGFQVTASHDLPSGSESWNSDQHNSPEVQGLWPNAHQNVVLLLLPGTDDGTLWRLLQCGHARLYGRCGGDQVLERIHSVPRTCEWHVQNLHGERTAWSLFNNPFYPVCPEECRKADHH,AFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTT

Amino Acids from 3' Exons

DQICKYVSLRAQHAAQERWKKNTNQHDTWNSCFSLQVWSSSSLFRMLRFSK,IRFASMSPGPNMLLKKDGRKIPTNSTIEHGTAASVCKYGAQVLNYSECCGFP,SDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQ