McDonnell Genome Institute

Washington University

CircRNA

chrX|133596439|133754176|-|GPC3|ENST00000370818.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9363

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

10

Peptide

FLAEAFEIVVRHAK

Amino Acids from 5' Exons

LLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLA,SEPCLCPKVEFWIKTWMRKGLKVETAVMMKMSALEALVMEKRISSASLQ,PENHVYAQRSSGKPGGRVKWRLRRVHWRLWWNDKSEESAPLPC

Amino Acids from 3' Exons

RPLKLLFAMPRTTPMPCSRTTTQALHKLLSLWVNFSQMCLSTSWVLTSMMTWSMNCLTACFQSSIPSTQACLIQPWTSMSASEEQDVTKYLGISPSLLPRFPSHCKSLGSSFRLILELKSTQLITSSVRTVAECSPECGTALTARDWLNPVAVTAMWSCKAVWQVWWRLTSTGENTFCPLKNLMACTESMTWRTYCLVSFQQSMILSSMSRRMQESPP,GLNCCSPCQELHQCHVQEQLPKPDSTSFVCGIFHRCVSLHLGFHQCRHGQIVQPVSSHLYPANEPRPAFSLGHQVPPRSKTPESIWEFPQAYYDPGFQVTASHDLPSGSESWNSDQHNSPEVQGLWPNAHQNVVLLLLPGTDDGTLWRLLQCGHARLYGRCGGDQVLERIHSVPRTCEWHVQNLHGERTAWSLFNNPFYPVCPEECRKADHH,AFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTT