McDonnell Genome Institute

Washington University

CircRNA

chrX|123627692|123639027|-|THOC2|ENST00000245838.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9969

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

7

Peptide

AIDDNQEMILSQIQK

Amino Acids from 5' Exons

SKYDELKKSEKGSKQQHKVHKYITSCEMVMAPVHEAVVSLHVSKVWDDISPQFYATFWSLTMYDLAVPHTSYEREVNKLKVQMKAIDDNQEM,QSMMNLKNQKREVNSNIKFISTLHHVRWWRLSMKQWSPYMFPKSGMTSALNSMLHSGHQCMTLQFHTPAMNEKSINLKSRKQLMTIRK,KVTKIRKGKTATSSVHYIMDGDGACPSSGLLTCFQSLGHQPSILCYILVIDNVPCSSTHQLTRSQTSPDESNQSGN

Amino Acids from 3' Exons

ILSQIQKYDNLITPVVDSLKYLTSLNYDVLA,SCHKYRSMITHLIHNTSLHIMMSWP,LVTNTEVLNNTCSRFIEIPHFTELCLG