McDonnell Genome Institute

Washington University

CircRNA

chrX|123625911|123626662|-|THOC2|ENST00000245838.12

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9948

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

LQIFPHFFAMIDPQIK

Amino Acids from 5' Exons

NLPKMRPSQNFYSCVYFLDVFFQQLMLFTVLVLLNWYINRKLQIFPHFFAMI,IYQKDHHKISTAVYISSMYFFSNCCLLCSFCIGTSTENSKFFHTSLLS,STKNETITKFLQLCIFPRCIFSAIDAVYCARFVELVHQQKTPNFSTLLCYDR

Amino Acids from 3' Exons

PPNKKKKEKERCTALQDKLLEEEKKQMEHVQRVLQRLKLEKDNWLLA,PQIKRKKRRSAVLPFRTSFLKKKRNRWNMYREFYRDNWKRTTGFQ,PKKEKREGALYCPSGQASRRKETDGTCTESSTEIETGKGQLAFS