McDonnell Genome Institute

Washington University

CircRNA

chrX|117909300|117920370|-|KLHL13|ENST00000262820.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9001

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

NAAGELRL

Amino Acids from 5' Exons

VTLDNCVEVGRIANTYNLTEVDKYVNSFVLKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELRMYDEKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGYLYAVGGRNAAGEL,SLTTVLKLDGLPTPTIPKWINTLTVSSRIFLHCAQGSSNSLLSVLPSCFPVIALSTVLNLSSLRLPVVGFAWKSLGWTLLQNRTYDFHHHRSSLITCKRWISELTILVICFWKPAITKCHICSQLCSQTGLPLGLTPLTWLHEECGSSWLSVRNCACMMKRPMSGNRPPWMPQGTSMASPSLEIFSMWLADRVIMIQKEKRQLIQSSDLILDTINGCKLHLMKSAPSSTVPSKDICMQLVGEMQQVNC,HFRQLCSWTDCQHLQSNRSGIRQFRLEEFSCIAEHRGVLETPFASCLRAFQPALYTALGYLSLASPGRASDGLCCKINEEHTISTDDTTGAHLRANGGFHENQYLCEFAFGSQQLPNDAIYAASYAVRQDCHVHHSLGYTRRSAEAAAGCQGIAHVKGPVEIVSPHGCPKVPAWHRRHWKFSLCGWRTELYKRKNGSYSLQISSIQMDASCIFKKAHLLPPKCPQRISVCSWWAKCSRT

Amino Acids from 3' Exons

GFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFKAMFT,ALTSFDLKDCFVMPCQVTQMMLSLCIESWHLLVITSRLCSQ,LPASTRIALCDPDARHRCFPCASHDGICLLQGYVH