McDonnell Genome Institute

Washington University

CircRNA

chr9|97909959|97913558|-|C9orf156|ENST00000375119.7

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9963

33

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

GSCGHFR

Amino Acids from 5' Exons

VELYTFLELTYMAHPYTSSPTLSMTHRKMWSLQTLIYRITNIHQTLCPSLTARLTAVTSDSSQGVMSHNPTIALRGNLNVLKTELQKKTTHTVTQPEFSKHFLCTGRQWILVWNQDVIRVPAWQKNKLAHIAQRRAFQRKVQTRSKEWKEQQSCKEAGQRHSPWPLTALLEGLMELPAAWFLPGQRLLWPLKCGLLLMPRWTLGSSVHK,WSYIPFWNHDTWHTRTRHQALHSVLTAKCDGAFSRLFTEPTYTKHCVPVQQDQLPATALRVATTPPHEETMSRQNFRRKLPDTQHSQNSASISYAQGDSSGFWFGIKTSEFQRGRRTNWPILPREELFRERYRQEARKSGRSSSLARKQGRDTAHGPSLPCWKGWSSPQRGSCLGDRGSCGHFRSAVYSSCRDGPWAAQFT,GAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQ

Amino Acids from 3' Exons

DFVCFSQKWSFELGKSAASAEWCKDWSFFHKEPSSSQCNRTDPGQAGKGR,ILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVE,FCLFFTKMVIAVRQKCSLLGMVQRLEFFPQGALIVPMQDPWPSWKRK