McDonnell Genome Institute

Washington University

CircRNA

chr9|95453477|95485874|-|PTCH1|ENST00000331920.10

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9956

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

LSSTSLSVGGR

Amino Acids from 5' Exons

AFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIV,PFRPSATRTAGLCLPWSTCLHPSWMAPCPLCWECCWRDLSSTSLS,LSDGHRRQEPQGCACPGAHVCTRPGWRRVHSAGSADAGGIVRLHCQ

Amino Acids from 3' Exons

LEDEVVNIILARRLEKRLCLILNSYRPLKKKVLMSPQKRSYNTWTRHSRPAVSMYTCTT,WRTSKSIKLYSPEDWRRGYVSSTHDTDPRRRCCPDHRSAPTTPGLGTPGQPCPCIHVQQ,GGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYN