McDonnell Genome Institute

Washington University

CircRNA

chr9|92718538|92722808|-|BICD2|ENST00000356884.10

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9505

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

VAGAHPSSYPR

Amino Acids from 5' Exons

MEREKAGLLATLQDTQKQLEHTRGSLSEQQEKVTRLTENLSALRRLQASKERQTALDNEKDRDSHEDGDYYEVDINGPEILACKYHVAVAEAGELREQLKALRSTHEAREAQHAEEKGRYEAEGQALTEKVSLLEKASRQDRELLARLEKELKKVSDVAGETQGSLSVAQDELVTFSEELANLYHHVCMCNNETPNRVMLDYYREGQGGAGRTSPGGRTSPEARGRRSPILLPKGLLAPEAGRADGGTGDSSPSPGSSLPSPLSDPRREPMNIYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQELGPAVDKDKEALMEEILKLKSLLSTKREQITTLRTVLKANKQ,WSGKRRACWQRCRTHRSSWSTRGAPCQNSRRRPASQRIVPCGACRPARSGRQPWTTRRTVTAMRMGTTTRWTSTGLRSWPASTMWLWLRLASSASSSRHCAARTRLVRPSTPRRRAAMRLRARHSRRRSPCRRPAARTASCWPGWRRSRRATSPARHRAAVWPRMSWPSVRSWPISTTTCACATMRHPTVSCWTTTARARAGPAAPVPGAAPAPRRVAGAHPSSYPRGCWLLRRAEQMVGRGTAAPRLAPHCHHPVTHAGSPTSTTSLSSVTRSSTCRQPWTAPRSCHASALPLRSWAPPWTRTRKRLWRRSSSSRCSAPSGSRSPRCALCSRPTS,GAGKGGPAGNAAGHTEAAGAHAGLPVRTAGEGDPPHRESECPAAPAGQQGAADSPGQREGPQPGWGLLRGGHQRADLGLQVPCGCGGWRAPRAAQGTAQHARGSGPARRGEGPLGGPGTHGEGLPAREGQPPGPRAAGPAGEGAKEGERRRRRDTGQPECGPGAGDLQGAGQSLPPRVHVQQDTQPCHAGLLPRGPGRGRPHQSRGPHQPRGAWPALTHPPTQGAAGSGGPSRWWDGGQQPLAWLLTAITPEPTPGAHEHLQPDRYHPPDQAPAGSRGPHHGAVTPAHCLSGAGPRRGQGQGSAYGGDPQAEVAAQHQAGADHHAAHCAQGQQA

Amino Acids from 3' Exons

INQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQ,STRMWRSSVAACGMTSRSTNSGKLVCCRTTRNWRRRTSACRSKCLCSDRT,QPECGDPAWPPAGHQGVQIPGSSSAAGLLGTGGGEHQPAEASVCAQTEP