McDonnell Genome Institute

Washington University

CircRNA

chr9|92466357|92470781|-|ASPN|ENST00000375543.1

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9636

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

13

Peptide

DTFKGMNALHVLGLTSVPTNIPFDTR

Amino Acids from 5' Exons

GLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVL,VSTTTSRRFTQKPFPQRSCEGCICPTINVKYHLIFPNHQNSEFMKIKLRKYKRTHSKEMLYTFW,SDPEQQQANEDSPKSLSNHKEVAKAVSVPQSTKNTTSSQIISRTQNSKSENTKGHIQRNECFTRF

Amino Acids from 3' Exons

VPQSQPTFHLILECLIFKTIKLRKSKKMILKDSLHF,FDLSPNQHSIYSNASSKQNGNQRKFRTHFTL,LTSVPTNIPFDTRMLDLQNNKIKEIKENDFKGLTSLY