McDonnell Genome Institute

Washington University

CircRNA

chr9|92459631|92466571|-|ASPN|ENST00000375544.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9826

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

YLQGLILNNNK

Amino Acids from 5' Exons

AGPRKQQNHRYRKWESCHTTCERNTFGKQTKKNPFRITRVEIPP,LGLGNNKITDIENGSLANIPRVREIHLENNKLKKIPSGLPELKYLQ,WAETTKSQISKMGVLLTYHVEKYIWKTINKKSLQDYQSNTS

Amino Acids from 3' Exons

GLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVL,VSTTTSRRFTQKPFPQRSCEGCICPTINVKYHLIFPNHQNSEFMKIKLRKYKRTHSKEMLYTFW,SDPEQQQANEDSPKSLSNHKEVAKAVSVPQSTKNTTSSQIISRTQNSKSENTKGHIQRNECFTRF