McDonnell Genome Institute

Washington University

CircRNA

chr9|8517847|8636844|-|PTPRD|ENST00000355233.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9494

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

4

Peptide

VLAFTSIGDGPLSSDIQVITQTGAPPR

Amino Acids from 5' Exons

PYPNLQELLPRAQLQASHRGTLGTLSLFLITFSINLKTLRNFTKKLMGWRPHATVSLDVPTRIMNSGLLLSITLGGGLPANLCHKPQSKHHPVPRGMSRHECVRPPFWYSGRNLKSQMDRSKDIEFIIQWIPLNMSTTGNTMLTAKSLLLATCPRKHILSKSWLLPQLEMVPFQVTYKSSLRQE,LTQTSRNSCSDREHSYKHHTDVGLWEPACFLLHNSATKLGTLQRNWGGDHTLQCRWTKSLLGLIQGCCCQHWAGASQRTCANTNLRASTIQCPEGCPGTNVEFDHHFGTVEGTRAKWTDPRISLLYNGSHSTCQQLDETQCSQPNHYYWQLSAPENIFCQSPGFYLNWRWSPFKHTSHHSDR,LPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKPKNSEELYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG

Amino Acids from 3' Exons

HLQGLHEHPLIRQGSLAELPLSSAKLRETQDLKLSGTKKERKSAIRDL,TSKVYTNTRSDRGLWRSCLFHLPSYGRPKTNCLEQKRKESQQSEI,PPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFE