McDonnell Genome Institute

Washington University

CircRNA

chr9|77797519|77922345|-|GNAQ|ENST00000286548.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9946

38

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

VSFSGTGESGK

Amino Acids from 5' Exons

LSLGPRSPCLPAYATRCASSSPHHRDHRIPLLTKCHFQ,YLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIF,ILMTWTALTLPTCLRNKMCLEFESPPQGSSNTPLTYKVSFS

Amino Acids from 3' Exons

GQERVARVRLSSRESSMGQDTLMKIKGASPSWCIRTSSRPCRPSEPWTHSRSHTSMSTI,DRREWQEYVYQADENHPWVRILRKGLHQAGVSEHLHGHAGHDQSHGHTQDPIQVAQ,TGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNK