McDonnell Genome Institute

Washington University

CircRNA

chr9|71734805|71740232|-|TMEM2|ENST00000377044.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

QPFSGQSQR

Amino Acids from 5' Exons

AFLFQDSGRLMESICMMLVVGNLETRLWSQAQTIPCTKQRSSLFFPVLNAAIFRSKSK,RFSFRIPGRGCRWSEAKFARCLETWRPDCGRKHRLFHVPSRGVHSSSLFMQPFSGQSQ,VSLSGFRVEVVDGVKLNLLDDVSSWKPGDQIVVASTDYSMYQAEEFTLLPCSECSHFQVKVK

Amino Acids from 3' Exons

ASLGFSWCHWWKHFLQIREKLKSQWREGSCPKRILYCGWPEVLCDSLMD,QAWALVGVIDGGSTSCNESVRNYENHSSGGKALAQREFYTVDGQKFSVTAYSEWIE,KLGLLVSLMVEALLAMNPETMKIIAVAGRLLPKENFILWMARSSLQLIVNGLK