McDonnell Genome Institute

Washington University

CircRNA

chr9|70537121|70537405|-|TRPM3|ENST00000377111.6

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9992

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

GHPAGAAGRPYR

Amino Acids from 5' Exons

GGEHVYAAGGSQRERALHEGFTPDRGHPAGAAGRPYRAHGHGPGAPDRSGAGRVQQNPLEDLVRLHGRRLHCPSEQLQQPGREHLQAPREYRPC,VENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPA,WRTCLCGWRKSTRESTPRLHSRPWTSGWRSWKTLSGAWPRPWSAQVWSGPSPTKSARGPRQTARTPPTLSVRAASTARKGTPSSSKRVTLQ

Amino Acids from 3' Exons

GGEHVYAAGGSQRERALHEGFTPDRGHPAGAAGRPYRAHGHGPGAPDRSGAGRVQQNPLEDLVRLHGRRLHCPSEQLQQPGREHLQAPREYRPC,VENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQESIDPA,WRTCLCGWRKSTRESTPRLHSRPWTSGWRSWKTLSGAWPRPWSAQVWSGPSPTKSARGPRQTARTPPTLSVRAASTARKGTPSSSKRVTLQ