top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|7011697|7014001|+|KDM4C|ENST00000381306.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9136

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

18

Peptide

MEQVSLFPVQSAAYGFMQNCLR

Amino Acids from 5' Exons

NCLRFCPLRRKWKKQSLGRNLSSTFGRRSPLTSQLSKSIMQQWPGSHTVPSALCSCRTT,IAGSVHGGSGRNRVLGETSHPPLADEVPLRSARVCNSGQDEATLCHLHSAHAVPQ,LPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHK

Amino Acids from 3' Exons

PDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAKCCVRVHA,QIAAMKKMMLDGRQNMKSLHRRERLSPSYQRCVLFIVKKINILHPMPSLKRMEQVSLFPVQSAAYGFMQ,RQQRKCMGDKIRSRYIGGKDAPHTRDVFYLRKYRIFSTQCLPRGWNKSPYFLCKVLRTGSC

bottom of page