McDonnell Genome Institute

Washington University

CircRNA

chr9|5787060|5831028|-|ERMP1|ENST00000462592.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9473

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

12

Peptide

VSPYVTWMFVTDYLEHITSIGPR

Amino Acids from 5' Exons

VSEEHPEGMVTVAIAAHYLSGEDKRSPQLDALKEKFPDWTFPSAWVCTYDLFVFSCGALSTCPVDTPCDMVSPYVTWMFV,FQKNILKEWSPWPLLPTICLGKTRDPLNWMLRKSSQIGHFPLPGCAPTISLYFNLVDELVHAQWILHVTWFLPMLRGCL,FRRTSRNGHRGHCCPLSVWGRQEIPSTGCSEGKVPRLDISLCLGVHLRSLCILILWMSSKYMPSGYSMHGFSLCYVDVCN

Amino Acids from 3' Exons

GLSTHNLHWPQDYRKSRKNSDRALPFGTDTDSAKQQPSDFSRCTTAHRLFHFLGRFYKLLQHHQCCGKAGTQRWSPACCLGLSFLSSKLT,DYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLANCHFDSVANSP,IILNTPPLAPGLQEVQKMKFPCTTFWNRLNLKCKATAFIRFQMYNGPQALLALISWEVLQAIMTTSPMLWSWNPEMEPSMLSWLIVILTQQTHQ