McDonnell Genome Institute

Washington University

CircRNA

chr9|3898690|3937189|-|GLIS3|ENST00000324333.14

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9124

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

6

Peptide

GPWDAPLDPGLTSIQFEGCEK

Amino Acids from 5' Exons

LRSSTELHPDLLTDCLTVQSLQPATSPRDAAAEGTVGRSPGPGPDLYS,CGPAQSSIQTCSQIASPCSPCSRPLPLEMLLLKGPWDAPLDPGLTSIQ,AVQHRAPSRPAHRLPHRAVPAAGHFPRCCCRDRGTLPWTRAPLF

Amino Acids from 3' Exons

FEGCEKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDT,LKVARRPFQGLKISRSTCGATQARSRICASIRVVRRPSVTPVTAPNTSGRIWT,RLREGLFKAKSQDPLAEPHRREAVFVPASGLSEGLQLQPRQTPADASGH