top of page

McDonnell Genome Institute

Washington University

CircRNA

chr9|36236831|36249397|-|GNE|ENST00000377902.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9979

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

LTQELYFK

Amino Acids from 5' Exons

VMMNLKITLLHYSTLPLTLSIPKCLNHWMHLSHLTSGPSCFQILTQ,CKIRLHCCTTAPCDHHAFHKNVINIGCTYLIQADPSPVSKYR,DDVKSKDYIVALQHPVTTDIKHSIKMFELTLDALISFNKRTLVLFPNIDA

Amino Acids from 3' Exons

ELYFKNLSKRNKQIMEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPEFFELDVVVLGSHLIDDY,NSILRTSQNETSKSWRRMEITESCGFVLLLVTVQIILNLPRSCLALKPNLSSLNLMLWYLALTMTM,TLFEPLKTKQANHGEEWKPKAAGLCCYLPCRLFTCPDHVWHNRTVLTCCGTWLSPDRLW

bottom of page