McDonnell Genome Institute

Washington University

CircRNA

chr9|36222776|36223502|-|GNE|ENST00000377902.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9858

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

5

Peptide

TLLHLSQAQGEIVK

Amino Acids from 5' Exons

AFPQVAVILGKELCCIQPNSKSGTLWTLGPPFLTLCISLCGTMMATVLPWRKGNLAKERDWKTLLHLSQAQ,HFHRWPCKSSGRNCAAFNQTDPRVELCGPDPPFHFASPCVGRQWQLCCPGGKEIWPRKGTGKLCYTYHRH,ISTGGRVNPREGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAALAERKFGQGKGLENFVTLITGT

Amino Acids from 3' Exons

GEIVKKYTQFNPKTYEERINLILQMCVEAAAEAVKLNCRILGV,VKLRSILSSILKPMKRGLISYRCVWKLQQKLNTAEFWE,NSEVYSVQSNLREDFNPTDVCGSCSRSCKTELQNFGS