McDonnell Genome Institute

Washington University

CircRNA

chr9|35710988|35711792|-|TLN1|ENST00000314888.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9944

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

14

Peptide

ECDNALRELELPPSTGTFQEAQSR

Amino Acids from 5' Exons

GSNQHQSAHHYVHPAGTRPEGVRPAGIG,AVTDSINQLITMCTQQAPGQKECDNALRELE,QLTASISSSLCAPSRHPARRSVITPCGNW

Amino Acids from 3' Exons

LPPSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAP,FLLALGHFKKLRAGMKLLLGIRQPQNWCRPLGEPLRTWLEPQADLDRTSAPSWKLVWRWQARL,SSHWDISRSSEPVESCCWAESGSHRTGAGLSGNPSGPGSSLRPIWTGLQHLPGSWCGDGRPGS