McDonnell Genome Institute

Washington University

CircRNA

chr9|35057375|35068362|-|VCP|ENST00000358901.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9975

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

VGALAASVQK

Amino Acids from 5' Exons

EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSF,RKRMIQCLRSVEITLKKPCALRAVLSVTMTFGSMRCLPRPFSRVGALAAS,GRRGSSADPSRSLRSHALCAPFCQQHSEVDVCPDPSAESGLWQLQ

Amino Acids from 3' Exons

FKRPINSHSQTEEPSQSVNCSHQGQQCGVLVP,SKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQ,QKVMTYQQPFSNRRTVPIGLLMKPSMRTTVWCPCP