McDonnell Genome Institute

Washington University

CircRNA

chr9|34290173|34297114|-|KIF24|ENST00000379166.2

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9367

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

KSMFFILMK

Amino Acids from 5' Exons

RQCHLLCLWTDRCWKDLHHDRNSEPRIVCSSCQRYLQATRSVPAKKAPLCVDQLLNLLWTALPPKKKK,GNATCFAYGQTGAGKTYTMIGTHENPGLYALAAKDIFRQLEVSQPRKHLFVWISFYEIYCGQLYDLLNRRK,AMPLALLMDRQVLERPTPELMRTQDCMLLPKISSGNKCPSQESTSLCGSASMKFTVDSFMTSIEEK

Amino Acids from 3' Exons

HVFYFDEVFGEACTNQDVYMKTTHPLIQHIFN,MFFILMKSLVRRAPIRMYTRLLTHLFSIFSM,CFLFSLWGVHQSGCIHEDYSPTYSAYFQW