McDonnell Genome Institute

Washington University

CircRNA

chr9|21970901|21971208|-|CDKN2A|ENST00000304494.9

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9699

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

RCPGGLPGHAGGAAPGR

Amino Acids from 5' Exons

VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPS,SWAAPEWRSCCCSTARSPTAPTPPLSPDPCTTLPGRASWTRWWCCTGPGRGWTCAMPGAVCPWTWLRSWAIAMSHGTCARLRGAPEAVTMPAMPRKVPQ,HDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPGGAGPSRCRTVPARGCGGHQRQPCPHRCRGRSL

Amino Acids from 3' Exons

VMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPS,SWAAPEWRSCCCSTARSPTAPTPPLSPDPCTTLPGRASWTRWWCCTGPGRGWTCAMPGAVCPWTWLRSWAIAMSHGTCARLRGAPEAVTMPAMPRKVPQ,HDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPGGAGPSRCRTVPARGCGGHQRQPCPHRCRGRSL