McDonnell Genome Institute

Washington University

CircRNA

chr9|15472631|15490124|-|PSIP1|ENST00000380715.5

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9984

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

6

Peptide

KQEEQMETEHAFLGPK

Amino Acids from 5' Exons

KRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETE,REKVGGTFRLLTEGICKANMRKKQQIENASKRNKWKLS,EKRWEELSDCSQKEYAERPTERSSRSKTQARGTNGNA

Amino Acids from 3' Exons

CFFRTKGYISLLRKGKVWQTKKKRFRFMGDRQSKSEIFKST,AFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQ,LFDQRIYFLTQKIRKSMANQIKEKVLMKVYGRITIQKNFQVN