McDonnell Genome Institute

Washington University

CircRNA

chr9|14784369|14842660|-|FREM1|ENST00000380880.3

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9858

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

LSPVTDSGGK

Amino Acids from 5' Exons

VILSSLQNHSWCLKVIEVSQPPRSWLWTEQTSLRNCSMSSPPLRDMARSNMFTILEFPLQTSAKWMWGRQFAMYTRARLSPVTDS,YCHPYKTTRGVRRFLNNHHAPGCGRNRQAGTALCHHLPSAIWPDRICSLSWSSHYKLQPNGCSGADSLLCTQEQGDCLQQIQ,DIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLYVITSPPRYGQIEYVHYPGVPITNFSQMDVVGQTVCYVHKSKVTVSSDRF

Amino Acids from 3' Exons

GGKGFSSPWLTSRLELFAIIMMTATPPKTSWSSGYLMAITASVTNSPSTSCPKMIVPRSSPMLLNWRRGRPSSRDPCCELQMWTPVMTTSSSISQSLHRLGRSRSQGQD,GERVSLHRGPPGWSCSLSSQRLHQRLRGLPDIWPSQHPSQIPHQRLAQRSPVPHNQCCDTGGGADHPDPGIHAASFRCGRQLHLLQYHKASTGWGDHEEARARTD,GKGFLFTVADLQAGVVRYHHDDSDSTKDFVVFRIFDGHHSIRHKFPINVLPKDDSPPFLITNVVIELEEGQTILIQGSMLRASDVDASDDYIFFNITKPPQAGEIMKKPGPGLI